PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462930525
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family B3
Protein Properties Length: 310aa    MW: 34278.6 Da    PI: 8.8092
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462930525genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B332.91.1e-1021981198
               HHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
         B3 11 lksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98
               ++++ l++p + a+e+g       + +++ + g++W+v++   +++++ +l++GW+ F++a  +  g ++v+++ g  ++ l+vk+f+
  462930525 21 FSRSTLRIPDELAAEIGAA-----EARIR-SGGKVWSVEV--GQNGDGAFLGRGWRAFADACVVGGGWVLVLRYRG--GGVLTVKAFD 98
               567889**********866.....45555.599*******..999999*************************965..7778999987 PP

2B347.24e-151472151991
                -HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
         B3  19 pkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefe 91 
                   f +++g+ +++++tl+    s +sW++    +kk+ +++l +GW++F+++n LkegD+++F ++++   +
  462930525 147 ATAFSNAIGLREPCTITLKTSMDSTESWQMHGLPWKKR-SFLLVQGWRRFCQENSLKEGDSCIFNVVKT---T 215
                5567777799988977777777888*******888886.789999*******************97653...3 PP

3B342.61.1e-132282951784
                E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
         B3  17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                +l+  f+e++g+ +++++tl+   +s  sW+ ++    + ++++ + GW +F+++n++k+gD+++F  
  462930525 228 YLSQVFCEAIGIREACTITLKTSRSSTMSWQARVLPYDYCSHHIVGPGWTSFCRENRIKVGDVCTFNI 295
                67888********99988888888888*******7788888999**********************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508639.58711100IPR003340B3 DNA binding domain
SMARTSM010190.07217100IPR003340B3 DNA binding domain
PfamPF023621.9E-82198IPR003340B3 DNA binding domain
CDDcd100171.82E-62298No hitNo description
Gene3DG3DSA:2.40.330.105.0E-1023102IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.49E-924102IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.5E-15146221IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.659146225IPR003340B3 DNA binding domain
SuperFamilySSF1019367.85E-15146222IPR015300DNA-binding pseudobarrel domain
PfamPF023626.1E-12150221IPR003340B3 DNA binding domain
CDDcd100179.58E-9154209No hitNo description
SMARTSM010190.0019211309IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.6E-13227305IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.16E-12228306IPR015300DNA-binding pseudobarrel domain
PfamPF023621.2E-10228295IPR003340B3 DNA binding domain
CDDcd100173.01E-8233293No hitNo description
PROSITE profilePS508639.248244309IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MASSGHPVAA ARKQLRMLLP FSRSTLRIPD ELAAEIGAAE ARIRSGGKVW SVEVGQNGDG  60
AFLGRGWRAF ADACVVGGGW VLVLRYRGGG VLTVKAFDDT ACIRELGAPT TPSGNKDSPF  120
SPKKETKVSI TSGWIELLSC FLLEALATAF SNAIGLREPC TITLKTSMDS TESWQMHGLP  180
WKKRSFLLVQ GWRRFCQENS LKEGDSCIFN VVKTTLWHVV IKHCKEQYLS QVFCEAIGIR  240
EACTITLKTS RSSTMSWQAR VLPYDYCSHH IVGPGWTSFC RENRIKVGDV CTFNIVEPTL  300
WDVVITPRIS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLK3YBQ96e-47K3YBQ9_SETIT; Uncharacterized protein
STRINGSi011653m2e-46(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31690.14e-09B3 family protein